Transporter Protein
KVU_0430


Return to the Searched Organism New Organism Search
    Transport Function
Transporter Name: The ATP-binding Cassette (ABC) Superfamily
Transporter Type: ATP-Dependent
Transporter Family: ABC (TC#: 3.A.1)
The ATP-binding Cassette (ABC) Superfamily
Transporter Subfamily: membrane
Substrate/Function: dipeptide/oligopeptide
TC#: 3.A.1
^ Return to the top ^

    Genome Locus
PID:        Blast
Source:   Ketogulonicigenium vulgare WSH001
Chromosome:   not available
Location:   not available
Gene:   KVU_0430
Length:  368 aa
Strand:  not available
NCBI Protein Code:   ZP_08861232.1
COG:   COG4239
Product:  COG4239, ABC-type uncharacterized transport system, permease component [General function prediction only].
^ Return to the top ^

    Transmembrane Segment
TMSs: 
TMHMM Server 
Total:     6
TMS 1:  20-42
TMS 2:  170-192
TMS 3:  205-227
TMS 4:  231-253
TMS 5:  283-305
Topology:   >KVU_0430
MAISTLNRRRWRNFRKNGRAFWSLVIFAVLFTISLFAEFVANDKPLVVSYRGELHFPMTRFYAERDFGGD
LPTAARYKDIELQCLIATGGLESCFDDPGAMIAAADSGAVDDPGFVKGWMLWPLIPYHYSTIVDIPGAAP
SAPNGHNWLGTDDTKRDVLARVIYGVRLSIIYALVVTVATSVIGIAVGAASGYFGGWVDLILQRIIEIWS
ATPTLYVIIILFAVLGRSLSLLIFLAILFGWMGLVGVVRAEFLRARNFEYVRAARALGVSDIAIMARHML
PNAMVATLTMLPFIVTGQIGALAALDFMGFGLPSSAPSLGELAQQAKDNLQAPWLGFTAFFTFAIMLTLL
VFIFEGVRDAFDPRKTFR
^ Return to the top ^

    Sequence
Protein Sequence: >KVU_0430 ZP_08861232.1 [Ketogulonicigenium vulgare WSH001]
MAISTLNRRRWRNFRKNGRAFWSLVIFAVLFTISLFAEFVANDKPLVVSYRGELHFPMTRFYAERDFGGD
LPTAARYKDIELQCLIATGGLESCFDDPGAMIAAADSGAVDDPGFVKGWMLWPLIPYHYSTIVDIPGAAP
SAPNGHNWLGTDDTKRDVLARVIYGVRLSIIYALVVTVATSVIGIAVGAASGYFGGWVDLILQRIIEIWS
ATPTLYVIIILFAVLGRSLSLLIFLAILFGWMGLVGVVRAEFLRARNFEYVRAARALGVSDIAIMARHML
PNAMVATLTMLPFIVTGQIGALAALDFMGFGLPSSAPSLGELAQQAKDNLQAPWLGFTAFFTFAIMLTLL
VFIFEGVRDAFDPRKTFR
^ Return to the top ^

    Publications
Publications on this gene:
1.  J Bacteriol 193 (13), 3401-3402 (2011)
TITLE Genome sequence of strain TW15, a novel member of the genus Ruegeria, belonging to the marine Roseobacter clade

AUTHORS Lee,J., Roh,S.W., Whon,T.W., Shin,N.R., Kim,Y.O. and Bae,J.W.


2.  Submitted (24-FEB-2011)
TITLE Direct Submission

AUTHORS Lee,J. and Bae,J.-W.

Comment In: WGS REFSEQ: This record is provided to represent a collection of whole genome shotgun sequences. The reference sequence was derived from AEYW01000007. Source DNA and bacteria are available from Korean Agricultural Culture Collection (KACC 15115T) and National Institute of Agricultural Biotechnology (JCM 17315T). ##Genome-Assembly-Data-START## Assembly Method :: Newbler v. 2.3 Genome Coverage :: 44x Sequencing Technology :: 454 GS FLX Titanium ##Genome-Assembly-Data-END## ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Name :: GCF_000192475.1-RS_2025_03_27 Annotation Date :: 03/27/2025 03:41:21 Annotation Pipeline :: NCBI Prokaryotic Genome Annotation Pipeline (PGAP) Annotation Method :: Best-placed reference protein set; GeneMarkS-2+ Annotation Software revision :: 6.9 Features Annotated :: Gene; CDS; rRNA; tRNA; ncRNA Genes (total) :: 4,430 CDSs (total) :: 4,379 Genes (coding) :: 4,324 CDSs (with protein) :: 4,324 Genes (RNA) :: 51 rRNAs :: 1, 1, 1 (5S, 16S, 23S) complete rRNAs :: 1, 1, 1 (5S, 16S, 23S) tRNAs :: 45 ncRNAs :: 3 Pseudo Genes (total) :: 55 CDSs (without protein) :: 55 Pseudo Genes (ambiguous residues) :: 0 of 55 Pseudo Genes (frameshifted) :: 14 of 55 Pseudo Genes (incomplete) :: 37 of 55 Pseudo Genes (internal stop) :: 12 of 55 Pseudo Genes (multiple problems) :: 8 of 55 ##Genome-Annotation-Data-END## Method: conceptual translation.

^ Return to the top ^
    NBCI Gene Page
^ Return to the top ^