Transporter Protein
LBA0423


    Transport Function
Transporter Name: LBA0423
Transporter Type: Ion Channels
Transporter Family: MscL (TC#: 1.A.22)
The Large Conductance Mechanosensitive Ion Channel (MscL) Family
Transporter Subfamily: 
Substrate/Function: large-conductance mechanosensitive ion channel
TC#: 
^ Return to the top ^

    Genome Locus
PID:   58336760     Blast
Source:   Lactobacillus acidophilus NCFM
Chromosome:   -
Location:   399894..400268
Gene:   -
Length:  124
Strand:  -
Code:   -
COG:   -
Product:  channel protein
^ Return to the top ^

    Transmembrane Segment
TMSs: 
TMHMM Server 
Total:     2
TMS 1:  13-35
TMS 2:  68-87
Topology:   >LBA0423
MLTEFKQFIARGNVIDLAVGVIIGAAFTAIVQSLVKNLINPLIGIFVGKIDLSNLVFKAGDATFKYGSFI
NSVINFLIISFVVFLIVKAVNKITKKEEEEKPDTPTETDYLKEIRDLLKEKETK
^ Return to the top ^

    Sequence
Protein Sequence: >LBA0423 58336760 channel protein [Lactobacillus acidophilus NCFM]
MLTEFKQFIARGNVIDLAVGVIIGAAFTAIVQSLVKNLINPLIGIFVGKIDLSNLVFKAGDATFKYGSFI
NSVINFLIISFVVFLIVKAVNKITKKEEEEKPDTPTETDYLKEIRDLLKEKETK
DNA Sequence: >LBA0423 58336760 channel protein [Lactobacillus acidophilus NCFM]
ATGCTTACAGAATTTAAACAATTCATTGCCCGCGGAAACGTAATTGATTTAGCTGTTGGTGTTATCATCG
GAGCTGCCTTTACTGCAATTGTTCAATCACTTGTTAAAAATTTGATCAATCCTTTAATCGGCATCTTTGT
AGGTAAAATTGACTTATCTAATCTTGTTTTTAAGGCGGGAGACGCCACATTTAAATACGGTAGTTTTATA
AATTCCGTAATTAATTTCTTAATTATTTCTTTCGTAGTCTTTTTAATTGTTAAAGCTGTTAATAAAATTA
CCAAAAAAGAAGAGGAAGAAAAGCCTGACACACCTACTGAAACAGATTACTTAAAAGAAATCCGTGATTT
ACTTAAAGAAAAAGAAACAAAATAA
^ Return to the top ^

    Publications
Publications on this gene:
1.  Proc Natl Acad Sci U S A 2005 Mar 15; 11(102):3906-12.
Complete genome sequence of the probiotic lactic acid bacterium Lactobacillus acidophilus NCFM.

Altermann E ,Russell WM ,Azcarate-Peril MA ,Barrangou R ,Buck BL ,McAuliffe O ,Souther N ,Dobson A ,Duong T ,Callanan M ,Lick S ,Hamrick A ,Cano R ,Klaenhammer TR ,

Department of Food Science, Southeast Dairy Foods Research Center, North Carolina State University, Raleigh, NC 27695, USA.

Lactobacillus acidophilus NCFM is a probiotic bacterium that has been produced commercially since 1972. The complete genome is 1,993,564 nt and devoid of plasmids. The average GC content is 34.71% with 1,864 predicted ORFs, of which 72.5% were functionally classified. Nine phage-related integrases were predicted, but no complete prophages were found. However, three unique regions designated as potential autonomous units (PAUs) were identified. These units resemble a unique structure and bear characteristics of both plasmids and phages. Analysis of the three PAUs revealed the presence of two R/M systems and a prophage maintenance system killer protein. A spacers interspersed direct repeat locus containing 32 nearly perfect 29-bp repeats was discovered and may provide a unique molecular signature for this organism. In silico analyses predicted 17 transposase genes and a chromosomal locus for lactacin B, a class II bacteriocin. Several mucus- and fibronectin-binding proteins, implicated in adhesion to human intestinal cells, were also identified. Gene clusters for transport of a diverse group of carbohydrates, including fructooligosaccharides and raffinose, were present and often accompanied by transcriptional regulators of the lacI family. For protein degradation and peptide utilization, the organism encoded 20 putative peptidases, homologs for PrtP and PrtM, and two complete oligopeptide transport systems. Nine two-component regulatory systems were predicted, some associated with determinants implicated in bacteriocin production and acid tolerance. Collectively, these features within the genome sequence of L. acidophilus are likely to contribute to the organisms' gastric survival and promote interactions with the intestinal mucosa and microbiota.

Publication Type: Research Support, Non-U.S. Gov't; Research Support, U.S. Gov't, Non-P.H.S.; Research Support, U.S. Gov't, P.H.S.;

^ Return to the top ^

    External Links

   TIGR CMRTHE SEEDThe SEED  
^ Return to the top ^

    NBCI Gene Page
^ Return to the top ^