Transporter Protein
YhjI


    Transport Function
Transporter Name: YhjI
Transporter Type: Secondary Transporter
Transporter Family: MFS (TC#: 2.A.1)
The Major Facilitator Superfamily (MFS)
Transporter Subfamily: 
Substrate/Function: glucose
TC#: 2.A.1.7.3
^ Return to the top ^

    Genome Locus
PID:   16078116     Blast
Source:   Bacillus subtilis 168
Chromosome:   -
Location:   1124595..1125800
Gene:   Bsu1052
Length:  401
Strand:  -
Code:   G (Carbohydrate transport and metabolism)
COG:   COG0738
Product:  similar to hypothetical proteins
^ Return to the top ^

    Transmembrane Segment
TMSs: 
TMHMM Server 
Total:     12
TMS 1:  7-26
TMS 2:  41-63
TMS 3:  72-89
TMS 4:  99-121
TMS 5:  133-150
TMS 6:  155-177
TMS 7:  212-230
TMS 8:  245-267
TMS 9:  276-294
TMS 10:  304-326
TMS 11:  333-355
TMS 12:  360-382
Topology:   >YhjI
MLRGTYLFGYAFFFTVGIIHISTGSLTPFLLEAFNKTTDDISVIIFFQFTGFLSGVLIAPLMIKKYSHFR
TLTLALTIMLVALSIFFLTKDWYYIIVMAFLLGYGAGTLETTVGSFVIANFESNAEKMSKLEVLFGLGAL
SFPLLINSFIDINNWFLPYYCIFTFLFVLFVGWLIFLSKNREYAKNANQQVTFPDGGAFQYFIGDRKKSK
QLGFFVFFAFLYAGIETNFANFLPSIMINQDNEQISLISVSFFWVGIIIGRILIGFVSRRLDFSKYLLFS
CSCLIVLLIAFSYISNPILQLSGTFLIGLSIAGIFPIALTLASIIIQKYVDEVTSLFIASASFGGAIISF
LIGWSLNQDTILLTMGIFTTMAVILVGISVKIRRTKTEDPISLENKASKTQ
^ Return to the top ^

    Sequence
Protein Sequence: >YhjI 16078116 similar to hypothetical proteins [Bacillus subtilis 168]
MLRGTYLFGYAFFFTVGIIHISTGSLTPFLLEAFNKTTDDISVIIFFQFTGFLSGVLIAPLMIKKYSHFR
TLTLALTIMLVALSIFFLTKDWYYIIVMAFLLGYGAGTLETTVGSFVIANFESNAEKMSKLEVLFGLGAL
SFPLLINSFIDINNWFLPYYCIFTFLFVLFVGWLIFLSKNREYAKNANQQVTFPDGGAFQYFIGDRKKSK
QLGFFVFFAFLYAGIETNFANFLPSIMINQDNEQISLISVSFFWVGIIIGRILIGFVSRRLDFSKYLLFS
CSCLIVLLIAFSYISNPILQLSGTFLIGLSIAGIFPIALTLASIIIQKYVDEVTSLFIASASFGGAIISF
LIGWSLNQDTILLTMGIFTTMAVILVGISVKIRRTKTEDPISLENKASKTQ
DNA Sequence: >YhjI 16078116 similar to hypothetical proteins [Bacillus subtilis 168]
ATGTTAAGAGGGACATATTTATTTGGATATGCTTTCTTTTTTACAGTAGGTATTATCCATATATCAACAG
GGAGTTTGACACCATTTTTATTAGAGGCTTTTAACAAGACAACAGATGATATTTCGGTCATAATCTTCTT
CCAGTTTACCGGATTTCTAAGCGGAGTATTAATCGCACCTTTAATGATTAAGAAATACAGTCATTTTAGG
ACACTTACTTTAGCTTTGACAATAATGCTTGTAGCGTTAAGTATCTTTTTTCTAACCAAGGATTGGTATT
ATATTATTGTAATGGCTTTTCTCTTAGGATATGGAGCAGGCACATTAGAAACGACAGTTGGTTCATTTGT
TATTGCTAATTTCGAAAGTAATGCAGAAAAAATGAGTAAGCTGGAAGTTCTCTTTGGATTAGGCGCTTTA
TCTTTCCCATTATTAATTAATTCCTTCATAGATATCAATAACTGGTTTTTACCATATTACTGTATATTCA
CCTTTTTATTCGTCCTATTCGTAGGGTGGTTAATTTTCTTGTCTAAGAACCGAGAGTACGCTAAGAATGC
TAACCAACAAGTGACCTTTCCAGATGGAGGAGCATTTCAATACTTTATAGGAGATAGAAAAAAATCAAAG
CAATTAGGCTTTTTTGTATTTTTCGCTTTCCTATATGCTGGAATTGAAACAAATTTTGCCAACTTTTTAC
CTTCAATCATGATAAACCAAGACAATGAACAAATTAGTCTTATAAGTGTCTCCTTTTTCTGGGTAGGGAT
CATCATAGGAAGAATATTGATTGGTTTCGTAAGTAGAAGGCTTGATTTTTCCAAATACCTTCTTTTTAGC
TGTAGTTGTTTAATTGTTTTGTTGATTGCCTTCTCTTATATAAGTAACCCAATACTTCAATTGAGTGGTA
CATTTTTGATTGGCCTAAGTATAGCGGGGATATTTCCCATTGCTTTAACACTAGCATCAATCATTATTCA
GAAGTACGTTGACGAAGTTACAAGTTTATTTATTGCCTCGGCAAGTTTCGGAGGAGCGATCATCTCTTTC
TTAATTGGATGGAGTTTAAACCAGGATACGATCTTATTAACCATGGGAATATTTACAACTATGGCGGTCA
TTCTAGTAGGTATTTCTGTAAAGATTAGGAGAACTAAAACAGAAGACCCTATTTCACTTGAAAACAAAGC
ATCAAAAACACAGTAG
^ Return to the top ^

    Publications
Publications on this gene:
1.  J Bacteriol 1998 Feb ; 3(180):498-504.
Characterization of glucose-specific catabolite repression-resistant mutants of Bacillus subtilis: identification of a novel hexose:H+ symporter.

Paulsen IT ,Chauvaux S ,Choi P ,Saier MH Jr,

Department of Biology, University of California at San Diego, La Jolla 92093-0116, USA.

Insertional mutagenesis was conducted on Bacillus subtilis cells to screen for mutants resistant to catabolite repression. Three classes of mutants that were resistant to glucose-promoted but not mannitol-promoted catabolite repression were identified. Cloning and sequencing of the mutated genes revealed that the mutations occurred in the structural genes for (i) enzyme II of the phosphoenolpyruvate-glucose phosphotransferase (PtsG), (ii) antiterminator GlcT, which controls PtsG synthesis, and (iii) a previously uncharacterized carrier of the major facilitator superfamily, which we have designated GlcP. The last protein exhibits greatest sequence similarity to the fucose:H+ symporter of Escherichia coli and the glucose/galactose:H+ symporter of Brucella abortus. In a wild-type B. subtilis genetic background, the glcP::Tn10 mutation (i) partially but specifically relieved glucose- and sucrose-promoted catabolite repression, (ii) reduced the growth rate in minimal glucose medium, and (iii) reduced rates of [14C]glucose and [14C]methyl alpha-glucoside uptake. In a delta pts genetic background no phenotype was observed, suggesting that expression of the glcP gene required a functional phosphotransferase system. When overproduced in a delta pts mutant of E. coli, GlcP could be shown to specifically transport glucose, mannose, 2-deoxyglucose and methyl alpha-glucoside with low micromolar affinities. Accumulation of the nonmetabolizable glucose analogs was demonstrated, and inhibitor studies suggested a dependency on the proton motive force. We conclude that B. subtilis possesses at least two distinct routes of glucose entry, both of which contribute to the phenomenon of catabolite repression.

Publication Type: Research Support, U.S. Gov't, P.H.S.;

^ Return to the top ^

    External Links

   TIGR CMRTHE SEEDThe SEED  
^ Return to the top ^

    NBCI Gene Page
^ Return to the top ^