Transporter Protein
YfiC


    Transport Function
Transporter Name: YfiC
Transporter Type: ATP-Dependent
Transporter Family: ABC (TC#: 3.A.1)
The ATP-binding Cassette (ABC) Superfamily
Transporter Subfamily: ABC & Memebrane
Substrate/Function: drug?
TC#: 3.A.1.36.X
^ Return to the top ^

    Genome Locus
PID:   16077889     Blast
Source:   Bacillus subtilis 168
Chromosome:   -
Location:   895125..896939
Gene:   Bsu0822
Length:  604
Strand:  +
Code:   Q (Secondary metabolites biosynthesis, transport and catabolism)
COG:   COG1132
Product:  similar to ABC transporter (ATP-binding protein)
^ Return to the top ^

    Transmembrane Segment
TMSs: 
TMHMM Server 
Total:     5
TMS 1:  47-69
TMS 2:  84-106
TMS 3:  161-183
TMS 4:  188-207
TMS 5:  288-310
Topology:   >YfiC
MLKDIRKPFQYPKLPIDKKEGAKKRAKAKDTKGTLRRIWSYLAERKGLLILVMLMVVISAIFGLLGPFVI
GKAIDHFIVGKTVSGLIPVLLLLLAIYIIQSLSLWFQNYWMITISQGTVFRMRSELFTHLHELPIPFFDK
QRHGELMSRVTNDIENVSSTLNTSVIQILSSVITFVGTIAVMLYMSPLLTLITLTIIPVMAASLKWITNR
TGKLFKEQQKNLGDLNGYIEESVSGAKVIKAYSREKQITAEFLEKNAALKTSGFWAQTISGFIPKVMNSL
NNLSFTMIAAIGGLFALKGWISIGSIVVFAEYSRQFTRPLNDLANQFNTMLSAIAGAERVFDVLDEKEER
EDEKNAVHQPIQTGSIEFRDVSFGYDKGQQTLKHLQFTVPAGQSIAFVGPTGAGKTTVTNLLARFYEPND
GKILIDGTDIKTLTRASLRKNMGFVLQDSFLFQGTIRENIRYGRLDASDQEVEAAAKTANAHSFIERLPK
GYDTVLTQNGSGISQGQKQLISIARAVLADPVLLILDEATSNIDTVTEVNIQEALARLMEGRTSVIIAHR
LNTIQRADQIVVLKNGEMIEKGSHDELIRQKGFYSDLYESQFEK
^ Return to the top ^

    Sequence
Protein Sequence: >YfiC 16077889 similar to ABC transporter (ATP-binding protein) [Bacillus subtilis 168]
MLKDIRKPFQYPKLPIDKKEGAKKRAKAKDTKGTLRRIWSYLAERKGLLILVMLMVVISAIFGLLGPFVI
GKAIDHFIVGKTVSGLIPVLLLLLAIYIIQSLSLWFQNYWMITISQGTVFRMRSELFTHLHELPIPFFDK
QRHGELMSRVTNDIENVSSTLNTSVIQILSSVITFVGTIAVMLYMSPLLTLITLTIIPVMAASLKWITNR
TGKLFKEQQKNLGDLNGYIEESVSGAKVIKAYSREKQITAEFLEKNAALKTSGFWAQTISGFIPKVMNSL
NNLSFTMIAAIGGLFALKGWISIGSIVVFAEYSRQFTRPLNDLANQFNTMLSAIAGAERVFDVLDEKEER
EDEKNAVHQPIQTGSIEFRDVSFGYDKGQQTLKHLQFTVPAGQSIAFVGPTGAGKTTVTNLLARFYEPND
GKILIDGTDIKTLTRASLRKNMGFVLQDSFLFQGTIRENIRYGRLDASDQEVEAAAKTANAHSFIERLPK
GYDTVLTQNGSGISQGQKQLISIARAVLADPVLLILDEATSNIDTVTEVNIQEALARLMEGRTSVIIAHR
LNTIQRADQIVVLKNGEMIEKGSHDELIRQKGFYSDLYESQFEK
DNA Sequence: >YfiC 16077889 similar to ABC transporter (ATP-binding protein) [Bacillus subtilis 168]
ATGCTAAAAGACATCCGCAAGCCTTTCCAATATCCCAAACTGCCAATTGACAAAAAAGAAGGCGCGAAAA
AGCGGGCGAAAGCAAAGGATACAAAGGGCACACTGAGACGAATCTGGTCTTACTTGGCTGAAAGAAAAGG
ACTGCTCATACTTGTCATGCTAATGGTTGTCATCAGCGCCATATTCGGACTCCTTGGTCCCTTTGTGATC
GGAAAGGCCATCGACCATTTTATCGTCGGGAAAACGGTCAGCGGCTTGATTCCTGTTTTGCTTCTTCTGC
TCGCTATCTATATCATTCAGTCCCTGTCGCTTTGGTTTCAAAACTATTGGATGATTACGATCTCGCAGGG
CACGGTTTTCAGAATGAGAAGCGAATTGTTCACCCATCTGCATGAGCTGCCGATTCCATTTTTTGATAAA
CAGCGGCACGGCGAGCTGATGAGCCGGGTGACGAATGACATCGAAAATGTCAGTTCTACCTTAAACACGT
CAGTCATTCAAATTTTGTCAAGTGTGATCACCTTTGTCGGGACGATTGCGGTGATGCTGTACATGAGCCC
GCTCCTTACTTTGATTACGCTGACCATTATTCCGGTGATGGCAGCGAGCCTGAAATGGATCACCAACCGA
ACGGGAAAGCTGTTTAAAGAACAGCAGAAAAACCTTGGTGATCTGAATGGGTATATTGAGGAATCTGTTT
CAGGCGCAAAGGTCATCAAAGCATATTCACGTGAGAAGCAGATTACTGCTGAATTCCTCGAAAAAAACGC
TGCACTCAAGACGTCGGGCTTTTGGGCGCAGACGATTTCCGGGTTTATTCCGAAGGTCATGAACTCTTTG
AATAACTTAAGCTTTACAATGATTGCGGCAATCGGCGGTTTGTTTGCGCTGAAAGGCTGGATCTCGATCG
GCTCCATCGTTGTCTTTGCCGAGTATTCAAGACAATTTACACGCCCTTTAAACGATCTGGCCAACCAGTT
TAATACGATGCTGTCCGCAATCGCCGGCGCTGAACGGGTGTTTGACGTGCTTGATGAAAAAGAAGAGCGC
GAGGATGAAAAGAACGCCGTGCATCAGCCCATCCAAACAGGCAGCATTGAATTCCGGGATGTGTCCTTCG
GTTACGATAAAGGGCAGCAGACACTGAAGCATTTACAGTTTACCGTGCCTGCGGGGCAGTCCATCGCGTT
TGTAGGACCGACGGGGGCGGGGAAGACAACCGTCACTAACCTTCTCGCCCGTTTTTACGAGCCTAACGAT
GGAAAAATTTTAATCGATGGTACAGATATTAAAACCCTTACTAGAGCAAGCCTAAGAAAAAACATGGGGT
TTGTTCTTCAGGATTCTTTCTTATTTCAGGGAACGATCAGAGAAAACATTCGCTACGGCAGGCTTGATGC
TTCTGATCAGGAAGTCGAAGCCGCTGCAAAAACAGCGAATGCCCATAGTTTTATTGAAAGGCTGCCAAAA
GGGTATGACACCGTACTGACGCAAAACGGTTCGGGCATCAGTCAAGGGCAGAAGCAGTTGATTTCTATAG
CGAGGGCGGTGCTTGCCGATCCGGTTCTTCTCATTTTGGATGAAGCGACAAGCAACATTGATACCGTTAC
AGAAGTCAACATTCAAGAAGCGCTCGCCCGTTTAATGGAAGGAAGAACAAGCGTCATCATTGCCCACAGG
CTGAACACCATTCAAAGAGCGGACCAGATTGTGGTGCTAAAAAACGGTGAAATGATTGAAAAAGGCAGCC
ATGACGAGCTGATTCGGCAAAAAGGATTTTACAGTGACTTATATGAAAGCCAATTTGAGAAATAG
^ Return to the top ^

    Publications
Publications on this gene:
2.  Microbiology 1996 Jun ; (142 ( Pt 6)):1417-21.
Determination of a 12 kb nucleotide sequence around the 76 degrees region of the Bacillus subtilis chromosome.

Yamamoto H ,Uchiyama S ,Fajar AN ,Ogasawara N ,Sekiguchi J ,

Department of Applied Biology, Faculty of Textile Science and Technology, Shinshu University, Nagano, Japan.

The nucleotide sequence of a 12361 bp DNA segment in the 76 degrees region of the Bacillus subtilis chromosome has been determined. Ten putative ORFs were identified. The deduced amino acid sequences of the products of two of them (glv-1 and glv-2) exhibited high similarity to those of glvG (6-phospho-beta-glucosidase gene) and glvC [permease (the IIC domain) of the phosphotransferase system (PTS)], respectively, in the glv operon of Escherichia coli. The C-terminal region of Glv-2 exhibited similarity to the entire region of GlvB (the IIB domain of PTS) of E. coli, suggesting fusion of the glvC and glvB genes in B. subtilis. glv-1, yfiA and glv-2 seem to form an operon of a phosphoenolpyruvate:sugar PTS, followed by a presumed four-membered operon of an ABC transport system. Moreover, a presumed sugar symporter and its regulatory genes were located in this region.

Publication Type: Comparative Study; Research Support, Non-U.S. Gov't;

^ Return to the top ^

    External Links

   TIGR CMRTHE SEEDThe SEED  
^ Return to the top ^

    NBCI Gene Page
^ Return to the top ^